PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539047.1_FGP007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 842aa    MW: 92901.1 Da    PI: 6.5751
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539047.1_FGP007genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28495546152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  KN539047.1_FGP007 495 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 546
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541485566IPR003035RWP-RK domain
PfamPF020425.7E-26498546IPR003035RWP-RK domain
SuperFamilySSF542772.45E-21738833No hitNo description
SMARTSM006664.5E-25748830IPR000270PB1 domain
PfamPF005641.1E-15748829IPR000270PB1 domain
PROSITE profilePS5174519.116748830IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.2E-25748829No hitNo description
CDDcd064071.98E-33749829No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MDRNSDTTSK RVDQINSKWQ FHLSIDDNTD SSCLFKERLT QALRYFKEST DQHLLVQVWA  60
PVKSGDRYVL TTSGQPFVLD QQSIGLLQYR AVSMMYMFSV DGENAGELGL PGRVYKQKVP  120
EWTPNVQYYS STEYPRLNHA ISYNVHGTVA LPVFDPSVQN CIAVVELIMT SKKINYAGEV  180
DKVCKALEAV NLKSTEILDH PNVQICNEGR QSALVEILEI LTVVCEEHKL PLAQTWVPCK  240
YRSVLAHGGG VKKSCLSFDG SCMGEVCMST SDVAFHVIDA HMWGFRDACV EHHLQKGQGV  300
SGKAFIYRRP CFSKDISQFC KLEYPLVHYA RMFGLAGCFA ICLQSMYTGD DDYILEFFLP  360
PNCRNEDDQN ALLESILARM KKCLRTLKVV GNGDTNGVCL QISNVLIIET EDLKTNLHFE  420
NSEGCFRESP ESNGSQRAHE VDNDGNKVSI MSERHLLADD NSQNNGASVG RPNGSGASDS  480
LHKSNKPPER RRGKAEKTIS LDVLQQYFSG SLKNAAKSLG VCPTTMKRIC RQHGISRWPS  540
RKINKVNRSL SKLKQVIESV QGSDAAFNLT SITGPLPIPV GPSSDSQNLE KASPNKVAEL  600
SNLAVEGDRD SSLQKPIEND GNLAILMSQQ GFIDANNNLQ LEADKASHSR SSSGEGSINS  660
RTSEASCQGS PANQTFVCKP IASTFAEPQL IPEAFTKEPF QEPALPLSRM LIEDSGSSKD  720
LKNLFTSAVD QPFLARSSNL ALMQNSGTVT IKASFKEDIV RFRFPCSGSV TALKDEVAKR  780
LRMDVGIFDI KYLDDDHEWV KLACNADLEE CMEISRHSGS HVIRLLVSDV AAHLGSSCGS  840
SG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0D9Y5S90.0A0A0D9Y5S9_9ORYZ; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7